slider

Brands

ADP-GloKinase Assay PDK1 Kinase Enzyme System. Substrate: PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFD ... Read more

Product # : PAV9681 Class : AVNTR Distributor : RELIANCE INC Category : Molecular Diagnostics

$0.00

Product Notices : This product may be non-returnable and/or require additional restocking fee.
Product Varient
Size

Product Specifications

Product No. # PAV9681
Manufacturer # V9681
Manufacturer Promega Corporation
Country of Origin US
Application Assay & kits
Shipping Width 3.75
Shipping Height 0.75
Shipping Depth 4.5
Dimension UOM IN
Shipping Weight 1
Weight UOM LB
QTY Per Sell 1
Size 1 each
Simply Medical Category Molecular Diagnostics
Class AVNTR
Supply Manager Category Molecular Diagnostics
Supply Manager Hierarchy
Clinical Laboratory>Genomics & Molecular Diagnostics>Molecular Diagnostics>Assay & kits
Legend Code No
Hazmat No