• 0
Shop Products $

ASIC3 antibody. ASIC3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ASIC3(56-73aa FLYQVAERVRYYREFHHQ)

IRAK4 antibody. IRAK4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IRAK4(45-59aa DDRYNQFHIRRFEAL), identical to the related rat and mouse sequences.

CD11b antibody. CD11b polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD11b(177-192aa MEQLKKSKTLFSLMQY)

SAPK4 antibody. SAPK4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4(343-360aa YKEIVNFSPIARKDSRRR)

CD163 antibody. CD163 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD163(1092-1109aa HQIQYREMNSCLNADDLD).

ABCG5 antibody. ABCG5 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ABCG5(116-131aa NGRALRREQFQDCFSY).

ABCG1 antibody. ABCG1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCG1(627-647aa ETCHFQKSEAILRELDVENAK), identical to the related rat and mouse sequences.

XRCC3 antibody. XRCC3 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse XRCC3(290-305aa NQLLMRLMVDRTHEDD), identical to the related rat sequence.

SOCS3 antibody. SOCS3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SOCS3(71-85aa RDSSDQRHFFTLSVK), identical to the related mouse sequence

CD62P antibody. CD62P polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD62P(49-66aa KAYSWNISRKYCQNRYTD

ABCB6 antibody. ABCB6 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB6(818-842aa YADMWQLQQGQEETSEDTKPQTMER).

HYAL2 antibody. HYAL2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HYAL2(142-157aa VRNWQDKDVYRRLSRQ)

LAMP1 antibody. LAMP1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LAMP1(403-417aa YLVGRKRSHAGYQTI)

PTCH2 antibody. PTCH2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PTCH2(885-901aa WLHDKYDTTGENLRIPP), different from the related mouse sequence by one amino acid.

MyD88 antibody. MyD88 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human MyD88(174-188aa FVQEMIRQLEQTNYR)

FOXP1 antibody. FOXP1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXP1(657-677aa HSPDFDHDRDYEDEPVNEDME), identical to the related rat and mouse sequences.

APLP2 antibody. APLP2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human APLP2(639-656aa EEKVINSKNKVDENMVID)

CD168 antibody. CD168 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD168(706-724aa KEGNTNCYRAPMECQESWK).

HDAC8 antibody. HDAC8 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC8(18-33aa YIYSPEYVSMCDSLAK)

TREM1 antibody. TREM1 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle of mouse TREM1(74-90aa FTRPSEVHMGKFTLKHD).

GAP43 antibody. GAP43 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAP43(216-238aa KPKESARQDEGKEEEPEADQEHA)

HMGB4 antibody. HMGB4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB4(24-41aa RNKFKEQQPNTYVGFKEF)

KCNN4 antibody. KCNN4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KCNN4(14-29aa RRKRLLEQEKSLAGWA)

Morg1 antibody. Morg1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Morg1(29-43aa RAVRFNVDGNYCLTC), identical to the related mouse and rat sequences.

Caspase-3(P10) antibody. Caspase-3(P10) Polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Caspase-3(P10)(220-236aa CAMLKQYADKLEFMHIL).

MTCO1 antibody. MTCO1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MTCO1(2-14aa FADRWLFSTNHKD).

MTCO1 antibody. MTCO1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MTCO1(501-514aa PYHTFEEPVYMKS).

MTCO1 antibody. MTCO1 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MTCO1(501-514aa PYHTFEEPTYVKVK), different from the related rat sequence by one amino acid.

C-Fos antibody. C-Fos polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human c-Fos(170-187aa DQLEDEKSALQTEIANLL), identical to the related rat and mouse sequences.

CD62L antibody. CD62L polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse CD62L(125-141aa KEDCVEIYIKRERDSGK), identical to the related rat sequence.

CDC42 antibody. CDC42 polyclonal antibody, Host: Rabbit, Species reactivity: Bovine, Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CDC42(121-138aa DDPSTIEKLAKNKQKPIT), identical to the related mouse and rat sequences.

FGFR1 antibody. FGFR1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FGFR1(806-822aa CLPRHPAQLANCGLKRR)

Fos B antibody. Fos B polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Fos B(1-15aa MFQAFPGDYDSGSRC), identical to the related mouse and rat sequences.

MEKK2 antibody. MEKK2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEKK2(606-619aa SADELLRHMFVHYH), different from the related rat and mouse sequences by one amino acid.

CXCR2 antibody. CXCR2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CXCR2(196-212aa CYEDMGNNTANWRMLLR), different from the related mouse sequence by six amino acids.

CD40L antibody. CD40L polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD40L(47-65aa HRRLDKIEDERNLHEDFVF)

Desmin Picoband antibody. Desmin Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Desmin recombinant protein (Position: M1-T304). Human Desmin shares 97% amino acid (aa) sequence identity with both mouse and rat Desmin

ALOX15 Picoband antibody. ALOX15 Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human ALOX15 recombinant protein (Position: G2-P337). Human ALOX15 shares 72% and 73% amino acid (aa) sequences identity with mouse and rat ALOX15, respectively

C5/C5a antibody. C5/C5a polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat C5a(1-18aa DLQLLHQKVEEQAAKYKH), different from the related mouse sequence by four amino acids.

CCL18 Picoband antibody. CCL18 Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human CCL18 recombinant protein (Position: A21-A89)

SynCAM antibody. SynCAM polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SynCAM(73-92aa VIQLLNPNRQTIYFRDFRPL), identical to the related mouse and rat sequences.

TMEM16A antibody. TMEM16A polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM16A(927-943aa KVLMVELFMREEQDKQQ)

EPB41L1 antibody. EPB41L1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EPB41L1(585-604aa QDQERDTVFLKDNHLAIERK)

Securin antibody. Securin polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Securin(146-161aa LMILDEERELEKLFQL), different from the related rat sequence by four amino acids

SLC16A4 antibody. SLC16A4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC16A4(134-148aa VVTTKYFKKRLALST)

IL1 beta Picoband antibody. IL1 beta Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Rat, isotype: IgG, E.coli-derived rat IL1 beta recombinant protein (Position: V117-S268). Rat IL1 beta shares 78% and 90% amino acid

Beclin 1 Picoband antibody. Beclin 1 Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Beclin 1 recombinant protein (Position: M1-S354). Human Beclin 1 shares 97% amino acid

FSH beta Picoband antibody. FSH beta Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, isotype: IgG, E.coli-derived human FSH beta recombinant protein (Position: N19-E129). Human FSH beta shares 90% and 89% amino acid

Myosin(Skeletal, Fast) antibody. Myosin(Skeletal, Fast) monoclonal antibody, Host: Mouse, Species Reactivity: Human, Mouse, Rabbit, Rat, MY-38, isotype: IgG1, Rabbit muscle myosin

Myosin(Skeletal, Slow) antibody. Myosin(Skeletal, Slow) monoclonal antibody, Host: Mouse, Species Reactivity: Human, Mouse, Rabbit, Rat, IML-64, isotype: IgG1, Human skeletal muscle myosin purified from myofibrils

SSH3BP1 antibody. SSH3BP1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SSH3BP1(483-494aa WYEGVCNRVTGL)

MAPK1/3 antibody. MAPK1/3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MAPK1/3(171-184aa ARVADPDHDHTGFL), identical to the related rat and mouse sequences.

NMDAR2B antibody. NMDAR2B polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NMDAR2B(1131-1146aa, DFYLDQFRTKENSPHW), identical to the related mouse and rat sequence.

NMDAR2B antibody. NMDAR2B polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NMDAR2B(1307-1320aa FVDLQKEEAALAPR), identical to the related mouse and rat sequences.

SLC12A6 antibody. SLC12A6 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SLC12A6(1060-1080aa QKAKSMEGFQDLLNMRPDQSN)

SLC22A1 antibody. SLC22A1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SLC22A1(533-550aa RKAKPKENTIYLKVQTSE), different from the related mouse and rat sequences by six amino acids.

Tuberin antibody. Tuberin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Tuberin(1605-1620aa QFTYCWHDDIMQAVFH), identical to the related mouse and rat sequences.

TNF beta antibody. TNF beta polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TNF beta(45-59aa AQTARQHPKMHLAHS).

Calponin antibody. Calponin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Calponin(283-297aa EPAHNHHAHNYYNSA)

Human MIF antibody. Human MIF Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human MIF recombinant protein(Position: M1-A115), for Macrophage migration inhibitory factor(MIF) detection. Tested with WB, ELISA in Human

Human NGF antibody. Human NGF Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human NGFB recombinant protein(Position: S122-A241), for Beta-nerve growth factor(NGF) detection. Tested with WB, ELISA in Human

Annexin V antibody. Annexin V polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin V(88-102aa SRLYDAYELKHALKG), identical to the related rat and mouse sequences.

PKC alpha antibody. PKC alpha polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human PKC alpha, identical to the related rat and mouse sequences.

TNF alpha antibody. TNF alpha polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TNF alpha(201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL)

Lamin A+C antibody. Lamin A+C polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lamin A+C(455-469aa RNKSNEDQSMGNWQI), identical to the related rat and mouse sequences.

Caspase-2 antibody. Caspase-2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Caspase-2(417-439aa REGYAPGTEFHRCKEMSEYCSTL)

NF-kB p65 antibody. NF-kB p65 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NF-kB p65(116-131aa AISQRIQTNNNPFQVP)

Caspase 4 antibody. Caspase 4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 4(104-124aa DALKLCPHEEFLRLCKERAEE).

CD90/Thy1 antibody. CD90/Thy1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD90(20-39aa QKVTSLTACLVDQSLRLDCR)

Caspase 9 antibody. Caspase 9 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Caspase 9(183-198aa SNIDCEKLRRRFSSLH).

IKK alpha antibody. IKK alpha polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IKK alpha(728-745aa NEEQGNSMMNLDWSWLTE).

AP2 alpha Picoband antibody. AP2 alpha Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Rat, isotype: IgG, E.coli-derived human AP2 alpha recombinant protein (Position: M1-G166). Human AP2 alpha shares 98% amino acid (aa) sequence identity with both mouse and rat AP2 alpha

Hamartin Picoband antibody. Hamartin Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Rat, isotype: IgG, E.coli-derived human Hamartin recombinant protein (Position: D686-Y884). Human Hamartin shares 96% and 95% amino acid

Tuberin Picoband antibody. Tuberin Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Tuberin recombinant protein (Position: H1611-V1807). Human Tuberin shares 94% and 90% amino acid

Ubiquitin Picoband antibody. Ubiquitin Picoband Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Ubiquitin recombinant protein (Position: M77-G152)

IL10 antibody. IL10 Polyclonal antibody, Host: Rabbit, Species Reactivity: Rat, isotype: IgG, E. coli-derived rat IL-10 recombinant protein(Position: S19-N178).

Lamin B1 antibody. Lamin B1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lamin B1(570-586aa FHQQGTPRASNRSCAIM), different from the related rat sequence by one amino acid

Stefin B antibody. Stefin B polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Stefin B(26-45aa QLEEKENKKFPVFKAVSFKS).

Gelsolin antibody. Gelsolin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Gelsolin(763-775aa WDDDYWSVDPLDR), identical to the related rat sequence

Leupaxin antibody. Leupaxin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Leupaxin(115-129aa KKHLPDKQDHKASLD), different from the related rat sequence by two amino acids

Human DDT antibody. Human DDT Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human DDT recombinant protein(Position: M1-L118).

Human IL6 antibody. Human IL6 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human IL-6 recombinant protein(Position: P29-M212).

Human IL7 antibody. Human IL7 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human IL-7 recombinant protein(Position: D26-H177).

VDAC/Porin antibody. VDAC/Porin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human VDAC(163-178aa RVTQSNFAVGYKTDEF), identical to the related rat and mouse sequences.

BCRP/ABCG2 antibody. BCRP/ABCG2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human BCRP/ABCG2(154-168aa NHEKNERINRVIQEL).

BCRP/ABCG2 antibody. BCRP/ABCG2 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse BCRP/ABCG2(152-167aa KNHEKNERINTIIKEL)

Matrilin 3 antibody. Matrilin 3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Matrilin 3(466-486aa NTKLDDILEKLKINEYGQIHR).

Prohibitin antibody. Prohibitin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Prohibitin(240-256aa KLEAAEDIAYQLSRSRN), identical to the related rat and mouse sequences.

SQSTM1/p62 antibody. SQSTM1/p62 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SQSTM1(91-110aa KDDIFRIYIKEKKECRRDHR)

PADI4/PAD4 antibody. PADI4/PAD4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PADI4(492-512aa ASPRSCYKLFQEQQNEGHGEA).

SCF antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Immunogen: E. coli-derived human SCF recombinant protein(Position: E26-A190), for Kit ligand/Mast cell growth factor(KITLG) detection

Granzyme B antibody. Granzyme B polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Granzyme B(168-184aa QEDRKCESDLRHYYDST).

N Cadherin antibody. N Cadherin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human N Cadherin(701-714aa CQCDSNGDCTDVDR), identical to the related rat and mouse sequences.

Annexin A2 antibody. Annexin A2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin A2(121-141aa RAEDGSVIDYELIDQDARDLY)

P cadherin antibody. P cadherin polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human P cadherin(612-626aa QDTYDVHLSLSDHGN), different from the mouse and rat sequences by one amino acid.

Galectin 1 antibody. Galectin 1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 1(119-135aa NYMAADGDFKIKCVAFD)

Annexin VI antibody. Annexin VI polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VI(636-652aa NIRREFIEKYDKSLHQA), identical to the related mouse and rat sequences.

Caveolin-1 antibody. Caveolin-1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Caveolin-1(164-178aa GKIFSNVRINLQKEI)

Cytoglobin antibody. Cytoglobin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Cytoglobin(50-68aa FVNFPSAKQYFSQFKHMED)

Human IL10 antibody. Human IL10 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human IL-10 recombinant protein(Position: S19-N178), for Interleukin-10(IL10) detection. Tested with WB, IHC-P, ELISA in Human

Category