• 0
Shop Products $

Peptide. Hec1 (phospho Ser 55) blocking peptide. Synonym: HEC, hsNDC80, NDC80 homolog, kinetochore complex component (S. cerevisiae), NDC80, KNTC2, TID3, HEC1. Species: Human

Antibody. Monoclonal p84 antibody, Clone Name: 5E10 Host: MouseP84 Antibody, THO complex 1 Antibody, P84N5 Antibody, HPR1 Antibody, THOC1 Antibody. Application: WB

Control Primer Pool. RN18S1 (18S) Control Primer Pool, Concentration: 100 uM, Storage Buffer: TE Buffer, Storage Instruction: Store at -20 degree C. Application: RT-PCR

Antibody. Polyclonal ESE1 antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: N-terminal sequence MAATCEISNIFSNYFS and C-terminal sequence SSGWKEEEVLQSRN of human ESE-1 protein. Synonym: ELF3, P78545, 1999, ESX, EPR1, 602191, ESE1, ESE-1, EPR-1, ERT, ESE 1, EPR 1

Antibody. Polyclonal Survivin antibody Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: Reacts with residues 125-142 EETAKKVRRAIEQLAAMD of the human Survivin protein. Synonym: Survivin, O15392, API4, EPR1, 332, 603352, EPR-1, BIRC5, EPR 1

Antibody. Polyclonal Humanin antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: Synthetic peptide - amino acids 9-24 of Human Humanin. Synonym: HN antibody HUNIN antibody

Antibody. Polyclonal Goat IgG (H+L) antibody Host: Rabbit, Species reactivity: Goat, Isotype: IgG, Synonym: Rabbit antiGoat IgG, anti-Goat IgG antibody, Goat IgG secondary antibody, antiGoat IgG antibody

Antibody. Polyclonal Leptin Receptor antibody Host: Rabbit, Species reactivity: Human, Mouse, Cow, Dog, Pig, Rat, Horse, Sheep, Isotype: IgG, Synonym: OBR Antibody, CD295 Antibody, LEP-R Antibody, OB-R Antibody, leptin receptor Antibody, LEPR Antibody, LEPRD Antibody. Application: ELISA.

Antibody. Polyclonal Leptin antibody Host: Rabbit, Species reactivity: Human, Mouse, Pig, Rat, Sheep, Isotype: IgG, Synonym: leptin Antibody, LEPD Antibody, LEP Antibody, OB Antibody, OBS Antibody. Application: ELISA, IHC-P, WB

Kpni-Hf- 4,000 Units. Kpni-Hf - 4,000 units

Antibody. Polyclonal CACNA2D2 antibody Host: Rabbit, Species reactivity: Mouse, Isotype: IgG, Immunogen: synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. Synonym: CACNA2D Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 2 Antibody

Antibody. Polyclonal BTN3A1 antibody Host: Rabbit, Species reactivity: Mouse, Isotype: IgG, Immunogen: synthetic peptide between 345-374 amino acids from the C-terminal region of human BTN3A1. Synonym: butyrophilin, subfamily 3, member A1 Antibody, BT3.1 Antibody, CD277 Antibody.

Antibody. Polyclonal Casein Kinase I gamma 3 antibody Host: Rabbit, Species reactivity: Mouse, Isotype: IgG, Immunogen: synthetic peptide between 333-361 amino acids from the C-terminal region of mouse Csnk1g3. Synonym: C330049O21Rik Antibody, 3300002K07Rik.

Antibody. Polyclonal Cdk15 antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: synthetic peptide between 96-124 amino acids from the N-terminal region of mouse Cdk15. Synonym: cyclin-dependent kinase 15 Antibody, Als2cr7 Antibody, Pftk2 Antibody

Antibody. Polyclonal ATL1 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: synthetic peptide between 477-504 amino acids from the C-terminal region of human ATL1. Synonym: SPG3 Antibody, GBP3 Antibody, FSP1 Antibody, AD-FSP Antibody, HSN1D Antibody

Antibody. Polyclonal COL8A1 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: synthetic peptide between 62-89 amino acids from the N-terminal region of human COL8A1. Synonym: collagen, type VIII, alpha 1 Antibody, C3orf7 Antibody

Antibody. Polyclonal CRLF3 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: synthetic peptide between 305-331 amino acids from the C-terminal region of human CRLF3. Synonym: p48.2 Antibody, FRWS Antibody, cytokine receptor-like factor 3 Antibody, CRLM9 Antibody

Antibody. Polyclonal CAMSAP3 antibody Host: Rabbit, Species reactivity: Human, Mouse, Isotype: IgG, Immunogen: synthetic peptide between 103-131 amino acids from the N-terminal region of human CAMSAP3. Synonym: member 3 Antibody, KIAA1543 Antibody, NEZHA Antibody

Antibody. Polyclonal B7-H6 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: synthetic peptide between 389-415 amino acids from the C-terminal region of human B7H6. Synonym: B7H6 Antibody, natural killer cell cytotoxicity receptor 3 ligand 1 Antibody.

Antibody. Polyclonal Sodium/Potassium ATPase alpha 3 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: synthetic peptide between 805-833 amino acids from the Central region of human ATP1A3. Synonym: RDP Antibody, AHC2 Antibody, DYT12 Antibody, ATPase

Antibody. Polyclonal COL9A1 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: synthetic peptide between 428-456 amino acids from the Central region of human COL9A1. Synonym: EDM6 Antibody, MED Antibody, DJ149L1.1.2 Antibody

Antibody. Polyclonal CNPY3 antibody Host: Rabbit, Species reactivity: Human, Dog, Pig, Rat, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: synthetic peptide directed towards the middle region of human CNPY3, Synonym: PRAT4A Antibody, TNRC5 Antibody, canopy 3 homolog (zebrafish)

Antibody. Monoclonal MelanA antibody Clone Name: [DT101 + BC199] Host: Mouse, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: Recombinant full length protein (Human). Synonym: Antigen SK29 AA, MART1, Melan A protein, Melanoma antigen recognized by T cells 1,

Antibody. Monoclonal BrdU antibody Clone name: [BrdU007] (ready-to-use) Conjugate: Biotin Host: Mouse, Isotype: IgG1, Synonym: Bromodeoxyuridine antibody BUdr antibody

Antibody. Polyclonal MMP2 antibody Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: ProMMP-2 purified from human cultured rheumatoid synovial fibroblasts, shown to be homogeneous by SDS-PAGE. Synonym: TBE-1, MMP2, CLG4A, P08253, CLG4, 120360, MMPII, 4313, MMP-II, MONA, TBE1

Antibody. Monoclonal Varicella Zoster virus antibody Clone name: SG1-1] Host: Mouse, Species reactivity: Human, Primate, Isotype: IgG1, Immunogen: VZV Ellen Strain from VZV infected monkey kidney cells (BSC1), Application: ELISA, ICC/IF, IP, WB

Antibody. Monoclonal Varicella Zoster virus antibody, Clone Name: SG4 Host: Mouse, Species reactivity: Monkey, Isotype: IgG1, Immunogen: VZV Ellen Strain from VZV-infected monkey kidney cells (BSC-1). Synonym: HHV3gp39

Antibody. Monoclonal Gentamycin antibody, Clone Name: 102 Host: Mouse, Isotype: IgG2a, Immunogen: Full length protein conjugated to KLH. Application: IA

Antibody. Polyclonal Copine 6 antibody Host: Rabbit, Species reactivity: Human, Mouse, Dog, Pig, Rat, zebrafish, Guinea pig, Horse, Rabbit, Sheep, Bovine, Isotype: IgG, Synonym: AU067659 Antibody, BB076446 Antibody, copine VI Antibody Application: WB

Antibody. Polyclonal BSND antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: synthetic peptide directed towards the middle region of human BSND, Synonym: BART Antibody, Bartter syndrome, infantile, with sensorineural deafness (Barttin) Antibody, DFNB73 Antibody

Antibody. Monoclonal beta HCG antibody Host: Mouse, Species reactivity: Human, Isotype: IgG, Synonym: hCGB Antibody, CGB8 Antibody, chorionic gonadotropin, beta polypeptide Antibody, CGB Antibody, CGB5 Antibody, CGB3 Antibody, CGB7 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal GM-CSF receptor alpha antibody Host: Rabbit, Species reactivity: Mouse, Rat, Isotype: IgG, Synonym: Csf2ra Antibody, GM-CSFR Antibody, GM-CSF-Ra Antibody, Csfgmra Antibody, CD116 Antibody, colony stimulating factor 2 receptor

Antibody. Polyclonal FGF8 antibody Host: Rabbit, Species reactivity: Human, Mouse, Chicken, Cow, Dog, Pig, Rat, Sheep, Isotype: IgG, Application: ELISA, WB

Antibody. Polyclonal PARP cleaved antibody (FITC) Host: Rabbit, Species reactivity: Human, Cow, Isotype: IgG, Immunogen: Synthetic peptide (Human) corresponding to N-terminus of cleavage site (214/215) of human PARP. Synonym: 142, pADPRT1, PARP-1, PARP cleaved, PARP, pADPRT-1, P09874, ADPRT1,

Antibody. Polyclonal AVL9 antibody Host: Rabbit, Species reactivity: Human, Mouse, Isotype: IgG, Immunogen is AVL9 (C-term). Application: IHC-P, WB

Antibody. Polyclonal CGRP antibody Host: Rabbit, Species reactivity: Human, Mouse, Chicken, Cow, Pig, Rat, Isotype: IgG, Immunogen: Synthetic peptide, Application: ELISA, IHC-P, WB

Antibody. Polyclonal Phospholamban antibody Host: Rabbit, Species reactivity: Rat, Isotype: IgG, Immunogen: peptide corresponding to a sequence at the N-terminus of human Phospholamban (2-16aa EKVQYLTRSAIRRAS), Synonym: PLB Antibody, CMH18 Antibody.

Antibody. Polyclonal VAMP3 antibody Host: Rabbit, Species reactivity: Human, Mouse, Chicken, Cow, Dog, Pig, Rat, Guinea pig, Horse, Isotype: IgG, Synonym: vesicle-associated membrane protein 3 Antibody, CEB Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal HVEML antibody Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: LTg Antibody, tumor necrosis factor (ligand) superfamily, member 14 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal NTCP antibody Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Synonym: solute carrier family 10 (sodium/bile acid cotransporter family), member 1 Antibody, SLC10A1 Antibody, Applications ELISA, IHC-P, WB

Antibody. Polyclonal CD303 antibody Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Synonym: PRO34150 Antibody, CLECSF7 Antibody, HECL Antibody, C-type lectin domain family 4, member C Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal CCL-7 antibody Host: Rabbit, Species reactivity: Mouse, Rat, Isotype: IgG, Synonym: Ccl7 Antibody, chemokine (C-C motif) ligand 7 Antibody, marc Antibody, mcp3 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal LEF1 antibody Host: Rabbit, Species reactivity: Human, Mouse, Chicken, Cow, Dog, Pig, Rat, Isotype: IgG, Synonym: TCF7L3 Antibody, LEF-1 Antibody, lymphoid enhancer-binding factor 1 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal Endothelin 1 antibody Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: CSCSSLMDKECVYFCHLDIIW (Disulfide bridges C1-C15, C3-C11). Application: ELISA, IHC-P, WB

Antibody. Polyclonal Cytokeratin 7 antibody Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Synonym: Krt2-7 Antibody, K7 Antibody, keratin 7 Antibody, D15Wsu77e Antibody, Krt7 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal NKp44 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Synonym: LY95 Antibody, CD336 Antibody, dJ149M18.1 Antibody, NCR2 Antibody, NKP44 Antibody, natural cytotoxicity triggering receptor 2 Antibody, NK-p44 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal CD33 antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Synonym: SIGLEC3 Antibody, CD33 molecule Antibody, SIGLEC-3 Antibody, p67 Antibody, Application: ELISA, IHC-P, WB

Antibody. Polyclonal CD8 antibody Host: Rabbit, Species reactivity: mouse, Isotype: IgG, Immunogen: immunizing rabbits with a synthetic peptide (KLH-coupled) corresponding to near N-terminal residues of Cd8a protein. Synonym: Lyt-2 Antibody, Ly-35 Antibody, Ly-B Antibody, CD8 antigen.

Antibody. Polyclonal PDX1 antibody Host: Rabbit, Species reactivity: Human, Mouse, Chicken, Pig, Rat, Isotype: IgG, Immunogen: Epitope mapping near the C-erminus of PDX1, Synonym: pancreatic and duodenal homeobox 1 Antibody, STF-1 Antibody, MODY4 Antibody, IDX-1 Antibody, IPF1 Antibody.

Antibody. Polyclonal Osteopontin antibody Host: Rabbit, Species reactivity: Mouse, Rat, Isotype: IgG, Synonym: BNSP Antibody, SPP1 Antibody, BSPI Antibody, secreted phosphoprotein 1 Antibody, OPN Antibody, ETA-1 Antibody. Application: ELISA, IHC-P, WB

Antibody. Polyclonal Nestin antibody Host: Rabbit, Species reactivity: Mouse, Rat, Isotype: IgG, Immunogen: Epitope mapping near the amino terminus of Nestin from mouse and rat, Synonym: ESTM46 Antibody, nestin Antibody, Nes Antibody, AA166324 Antibody, C78523 Antibody

Anti-Snap-Tag Antibody Polyclo. Anti-Snap-Tag antibody (polyclonal) - 100 ul

Antibody. Polyclonal CLPX antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: Synthetic peptide between 449-477 amino acids from the C-terminal region of human CLPX. Synonym: ClpX caseinolytic peptidase X homolog (E. coli) Antibody

Antibody. Polyclonal ACADM antibody Host: Rabbit, Species reactivity: Human, Mouse, Pig, Sheep, Isotype: IgG, Immunogen: Recombinant full length ACADM (Human), Synonym: P11310, MCADH, ACADM, ACAD1, 34, 201450, MCAD

Antibody. Monoclonal CD45 antibody Clone Name: K252-1E4 Host: Mouse, Species reactivity: Pig, Isotype: IgG1, Immunogen: Porcine Peripheral Blood lymphocytes, ApplicationsFACS, ICC/IF, IHC-Fr

Antibody. Polyclonal PPM1F antibody, N-term Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: KLH conjugated synthetic peptide between 18-48 amino acids from the N-terminal region of human PPM1F, Synonym: Partner of PIX 2; hFEM-2; Protein phosphatase 1F; POPX2

Antibody. Polyclonal SH3PXD2A antibody, N-term Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: KLH conjugated synthetic peptide between 221-250 amino acids from the N-terminal region of human SH3PXD2A, Synonym: SH3PXD2A;FISH; KIAA0418; SH3MD1

Antibody. Polyclonal Rad9 (phospho Ser387) antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: KLH conjugated synthetic peptide selected from the human RAD9A, Application: ELISA, ICC/IF, IHC, IHC-P, WB

Antibody. Polyclonal Rad9 (phospho Ser328) antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S328 of human Rad9, Application: Dot, ELISA, IHC, IHC-P, WB

Antibody. Polyclonal Rad9 (phospho Ser277) antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S277 of human Rad9, Application: ELISA, IHC, IHC-P, WB

Antibody. Polyclonal GLS2 antibody Host: Rabbit, Species reactivity: Huamn mouse, Isotype: IgG, Immunogen: Synthetic peptide between 505-532 amino acids from the C-terminal region of human GLS2. Application: IHC-P, WB

Antibody. Polyclonal LIPC antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: KLH conjugated synthetic peptide between 309-338 amino acids from the Central region of human LIPC. Application: FACS, IHC-P, WB

Antibody. Polyclonal ACER1 antibody Host: Rabbit, Species reactivity: Human, Dog, Pig, Rat, Guinea pig, Rabbit, Bovine, Isotype: IgG, Immunogen: synthetic peptide directed towards the C terminal, Synonym: ASAH3 Antibody, alkaline ceramidase 1 Antibody, ALKCDase1 Antibody

Antibody. Polyclonal Adiponectin Receptor 2 antibody Host: Rabbit, Species reactivity: Human, Dog, Guinea pig, Rabbit, Isotype: IgG, Immunogen: synthetic peptide directed towards the N terminal, Synonym: Adiponectin receptor 2 Antibody, ACDCR2 Antibody, PAQR2 Antibody

Antibody. Polyclonal Choroideremia antibody Host: Rabbit, Species reactivity: Human, Horse, Isotype: IgG, Immunogen: synthetic peptide directed towards the N terminal of human CHM, Synonym: DXS540 Antibody, choroideremia (Rab escort protein 1) Antibody, TCD Antibody.

Antibody. Polyclonal ZIC2 antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: Synthetic peptide located within the following region: EPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGSGSGGAGGGSGGGSGS, Application: IHC, WB

Antibody. Polyclonal CTNNB1 antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: Synthetic peptide directed towards the middle region of human CTNNB1, Application: WB, ChIP assay

Antibody. Polyclonal GLS antibody Host: Rabbit, Species reactivity: human, Isotype: IgG, Immunogen: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT, Application: WB

Antibody. Polyclonal Myocardin antibody Host: Rabbit, Species reactivity: Mouse, Isotype: IgG, Immunogen: Synthetic peptide corresponding to mouse myocardin, Application: WB

Antibody. Polyclonal CKII alpha antibody Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: Immunogen was a synthetic peptide, which represented a portion of human Casein kinase 2, alpha 2 polypeptide encoded within exon 11 (LocusLink ID 1459). Synonym: CK2A2, CSNK2A1, CKII alpha

BTBD14A Antibody. BTBD14A Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Dog, Rat, Guinea pig, Horse, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-BTBD14A antibody: synthetic peptide directed towards the C terminal of human BTBD14A

CREB3L2 Antibody. CREB3L2 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2

CNBP Antibody. CNBP Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Dog, Rat, Guinea pig, Rabbit, Isotype: IgG, Immunogen: The immunogen for anti-CNBP antibody: synthetic peptide directed towards the N terminal of human CNBP, Application: Westernblot

CLCN1 Antibody. CLCN1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Goat, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat, Synonymn: chloride channel

CLCN5 Antibody. CLCN5 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Dog, Rat, zebrafish, Guinea pig, Horse, Rabbit, Sheep, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Clcn5 antibody: synthetic peptide corresponding to a region of Mouse

CACNG1 Antibody. CACNG1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat, Synonymn: calcium channel, voltage-dependent

CACNG2 Antibody. CACNG2 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Dog, Pig, Rat, zebrafish, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Synonymn: calcium channel, voltage-dependent, gamma subunit 2 Antibody, Ipr328 Antibody, Application: WesternBlot

CACNG3 Antibody. CACNG3 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Pig, Rat, zebrafish, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Cacng3 antibody: synthetic peptide corresponding to a region of Mouse, Synonymn: calcium channel

CCDC16 Antibody. CCDC16 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-CCDC16 antibody: synthetic peptide directed towards the N terminal of human CCDC16

CCDC16 Antibody. CCDC16 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-CCDC16 antibody: synthetic peptide directed towards the middle region of human CCDC16

ALX4 Antibody. ALX4 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the C terminal of human ALX4, Synonymn: FND2 Antibody

Adrenocortical dysplasia Antibody. Adrenocortical dysplasia Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Acd antibody: synthetic peptide directed towards the c terminal of mouse Acd

ALX4 Antibody. ALX4 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Alx4 antibody: synthetic peptide directed towards the middle region of mouse Alx4, Synonymn: aristaless-like homeobox 4 Antibody

Conjugated Malondialdehyde Antibody. Conjugated Malondialdehyde Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Application: ELISA, IHC, IB

Conjugated Riboflavin (Vitamin B2) Antibody. Conjugated Riboflavin (Vitamin B2) Polyclonal Antibody, Host: Rat, Isotype: IgG, Immunogen: Synthetic Riboflavin conjugated to proteins carriers, Application: ELISA, IHC

ARX Antibody. ARX Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Rabbit, Isotype: IgG, Immunogen: The immunogen for anti-ARX antibody: synthetic peptide directed towards the middle region of mouse ARX, Synonymn: aristaless related homeobox Antibody

Nkx3.2 Antibody. Nkx3.2 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, zebrafish, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Bapx1 antibody: synthetic peptide directed towards the N terminal of mouse Bapx1

CIITA Antibody. CIITA Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Isotype: IgG, Immunogen: The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA, Synonymn: Ciita Antibody, class II transactivator Antibody, EG669998 Antibody

ASCL2 Antibody. ASCL2 Polyclonal Antibody, Host: Rabbit, Species: Mouse, Dog, Pig, Rat, Guinea pig, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the C terminal of mouse ASCL2, Application: Westernblot

ASCL2 Antibody. ASCL2 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, zebrafish, Guinea pig, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-ASCL2 antibody: synthetic peptide corresponding to a region of Mouse, Application: Westernblot

Ahrr Antibody. Ahrr Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: The immunogen for anti-Ahrr antibody: synthetic peptide corresponding to a region of Mouse, Synonymn: aryl-hydrocarbon receptor repressor Antibody, mKIAA1234 Antibody

Barx2 Antibody. Barx2 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Pig, Rat, zebrafish, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Barx2 antibody: synthetic peptide corresponding to a region of Mouse

Abt1 Antibody. Abt1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the middle region of mouse Abt1, Application: Westernblot

Abt1 Antibody. Abt1 Polyclonal Antibody, Host: Rabbit, Species: Mouse, Dog, Pig, Rat, Guinea pig, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the c terminal of mouse Abt1, Application: Westernblot

Atp6v0a1 Antibody. Atp6v0a1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Pig, Rat, Horse, Rabbit, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse, Application: IHC, Westernblot

CITED4 Antibody. CITED4 Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: The immunogen for anti-Cited4 antibody: synthetic peptide corresponding to a region of Mouse, Synonymn: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain

CITED4 Antibody. CITED4 Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: The immunogen for anti-CITED4 antibody: synthetic peptide directed towards the N terminal of mouse CITED4, Synonymn: Cbp/p300-interacting transactivator

ASCL3 Antibody. ASCL3 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Dog, Rat, Guinea pig, Horse, Bovine, Isotype: IgG, Immunogen: The immunogen for anti-Ascl3 antibody: synthetic peptide directed towards the middle region of mouse Ascl3, Application: Westernblot

Bola1 Antibody. Bola1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Rabbit, Isotype: IgG, Immunogen: The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1, Synonymn: 1810037G04Rik Antibody, bolA-like 1 (E. coli) Antibody

BHLHB4 Antibody. BHLHB4 Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: The immunogen for anti-Bhlhb4 antibody: synthetic peptide directed towards the n terminal of mouse Bhlhb4, Synonymn: basic helix-loop-helix family, member e23 Antibody, Bhlhe23 Antibody

Category