Rxreliance

GRK5 Kinase Enzyme System Sf9 Insect Cell 10ug. GRK5 Kinase Enzyme Easily Screen and Profile GRK5 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

ADP-GloKinase Assay GSK3 Alpha Kinase Enzyme System. Substrate: GSK3 Substrate (YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE); derived from human muscle glycogen synthase 1 (amino acid 636G661)

ADP-GloKinase Assay HER2 Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide

ADP-GloKinase Assay HER4 Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide.

ADP-GloKinase Assay IGF1R Kinase Enzyme System. Substrate: IGF1Rtide (KKKSPGEYVNIEFG); derived from human IRS-1 protein residues 891G902

ADP-GloKinase Assay InsR Kinase Enzyme System. Substrate: Axltide (KKSRGDYMTMQIG); derived from the mouse Insulin receptor substrate 1 (amino acid 979G989).

IRAK4 Kinase Enzyme System Sf9 Insect Cell 10ug. IRAK4 Kinase Enzyme Easily Screen and Profile IRAK4 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

ADP-GloKinase Assay ITK Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide

ADP-GloKinase Assay JAK3 Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide.

PAK4 Kinase Enzyme System Sf9 Insect Cell 10ug. PAK4 Kinase Enzyme Easily Screen and Profile PAK4 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

JNK3 Kinase Enzyme System Sf9 Insect Cell 10ug. JNK3 Kinase Enzyme Easily Screen and Profile JNK3 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

ADP-Glo Kinase Assay + ASK1 Kinase Enzyme System, 1 each, Promega - V9481, 1 each, ADP-Glo Kinase Assay + ASK1 Kinase Enzyme System, 1 each

ADP-GloKinase Assay LCK Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide.

ADP-GloKinase Assay LYN B Kinase Enzyme System. Substrate: SRC substrate (KVEKIGEGTYGVVYK-amide); derived from human p34cdc2 (amino acid 6G20)

CDK5/P25 Kinase Enzyme System Sf9 Insect Cell 10ug. CDK5/P25 Kinase Enzyme Easily Screen and Profile CDK5/P25 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

CDK5/P35 Kinase Enzyme System Sf9 Insect Cell 10ug. CDK5/P35 Kinase Enzyme Easily Screen and Profile CDK5/P35 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

ADP-GloKinase Assay c-MER Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide

ADP-GloKinase Assay MET Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide.

ADP-GloKinase Assay ROCK1 Kinase Enzyme System. Substrate: S6K substrate (KRRRLASLR); derived from human 40S ribosomal protein S6 (amino acid 230G238).

P38A Kinase Enzyme System Sf9 Insect Cell 10ug. P38A Kinase Enzyme Easily Screen and Profile P38A Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

P38 G Kinase Enzyme System Sf9 Insect Cell 10ug. P38 G Kinase Enzyme Easily Screen and Profile P38 G Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo Assay for bioluminescent detection of kinase activity, with Add ADP-Glo Assay, Size: 10ug

ADP-GloKinase Assay p70S6K Kinase Enzyme System. Substrate: S6K substrate (KRRRLASLR); derived from human 40S ribosomal protein S6 (amino acid 230G238)

ADP-GloKinase Assay RSK2 Kinase Enzyme System. Substrate: RSK Substrate (KRRRLSSLRA); Derived from human 40S ribosomal protein S6 (amino acid 230G239).

ADP-GloKinase Assay SGK1 Kinase Enzyme System. Substrate: Akt (PKB) substrate (CKRPRAASFAE)

ADP-GloKinase Assay PDK1 Kinase Enzyme System. Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1G14 are based on AKT1 (307G320) and residues 16G39 are based on PKN2/PRK2 (961G984).

ADP-GloKinase Assay PKC Alpha Kinase Enzyme System. Substrate: CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109G121)

ADP-GloKinase Assay PKC Beta II Kinase Enzyme System. Substrate: CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109G121).

ADP-GloKinase Assay PKC Gamma Kinase Enzyme System. Substrate: PKCtide (ERMRPRKRQGSVRRRV); derived from protein kinase C epsilon (amino acid 149G164)

ADP-GloKinase Assay PKC Delta Kinase Enzyme System. Substrate: CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109G121).

ADP-GloKinase Assay PKC Zeta Kinase Enzyme System. Substrate: CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109G121)

ADP-GloKinase Assay SRC Kinase Enzyme System. Substrate: SRC substrate (KVEKIGEGTYGVVYK-amide); derived from human p34cdc2 (amino acid 6G20).

ADP-GloKinase Assay PKC Iota Kinase Enzyme System. Substrate: CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109G121).

ADP-GloKinase Assay TRKA Kinase Enzyme System. Substrate: Poly (4:1 Glu, Tyr) Peptide.

Screening System Cyp2B6 P450-Glo 1000Assay. P450-Glo CYP2B6 Screening Systems, includes complete set of reagents, Luminescent format eliminates need for time-consuming analyses, Broad dynamic range and low background, assay employs luminogenic P450 substrates, Size: 1000 assays

Isopropanol, 30% (V/V) Aqueous Solution.